| Edit |   |
|---|
| Antigenic Specificity | ZFYVE21 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZFYVE21 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZFYVE21. This antibody reacts with human. The ZFYVE21 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is ZFYVE21 - middle region. Peptide sequence CALVSLKEAEFYDKQLKVLLSGATFLVTFGNSEKPETMTCRLSNNQRYLF. |
|---|
| Other Names | FYVE domain containing 21, ZF21MGC2550, zinc finger FYVE domain-containing protein 21, zinc finger, FYVE domain containing 21 |
|---|
| Gene, Accession # | ZFYVE21, Gene ID: 79038, Accession: NP_076976, SwissProt: NP_076976 |
|---|
| Catalog # | NBP1-98434-20ul |
|---|
| Price | |
|---|
| Order / More Info | ZFYVE21 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|