| Edit |   |
|---|
| Antigenic Specificity | WNK3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The WNK3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to WNK3. This antibody reacts with human. The WNK3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to WNK3(WNK lysine deficient protein kinase 3) The peptide sequence was selected from the N terminal of WNK3. Peptide sequence WVEDPKKLKGKHKDNEAIEFSFNLETDTPEEVAYEMVKSGFFHESDSKAV. |
|---|
| Other Names | EC 2.7.11, FLJ30437, KIAA1566FLJ42662, PRKWNK3lysine deficient 3, WNK lysine deficient protein kinase 3 |
|---|
| Gene, Accession # | WNK3, Gene ID: 65267, Accession: Q9BYP7, SwissProt: Q9BYP7 |
|---|
| Catalog # | NBP1-58361-20ul |
|---|
| Price | |
|---|
| Order / More Info | WNK3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|