| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | beta-1,4-Galactosyltransferase 1/B4GalT1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The beta-1,4-Galactosyltransferase 1/B4GalT1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to beta-1,4-Galactosyltransferase 1/B4GalT1. This antibody reacts with human. The beta-1,4-Galactosyltransferase 1/B4GalT1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human beta-1,4-Galactosyltransferase 1/B4GalT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS |
|---|
| Other Names | 1,4- galactosyltransferase, polypeptide 1, B4GAL-T1, beta-1,4-galactosyltransferase 1, Beta-1,4-GalTase 1, Beta4Gal-T1, betaGlcNAc beta, CDG2D, EC 2.4.1, GGTB2DKFZp686N19253, glycoprotein-4-beta-galactosyltransferase 2, GT1, GTB, lactose synthase, MGC50983, UDP-Gal, UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 1, UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 1 |
|---|
| Gene, Accession # | B4GALT1, Gene ID: 2683 |
|---|
| Catalog # | NBP1-88655 |
|---|
| Price | |
|---|
| Order / More Info | beta-1,4-Galactosyltransferase 1/B4GalT1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|