| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | beta-1,4-Galactosyltransferase 2/B4GalT2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to beta-1,4-Galactosyltransferase 2/B4GalT2. This antibody reacts with human. The beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human beta-1,4-Galactosyltransferase 2/B4GalT2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PYAGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKRDGIGSVRYQVLEVSRQPLFTNITV |
|---|
| Other Names | B4Gal-T2, B4Gal-T3, beta-1,4-galactosyltransferase 2, Beta-1,4-GalTase 2, beta-4-GalT2, beta4Gal-T2, beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase 2, EC 2.4.1.-, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase 2, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2, UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 2, UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 2, UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 2 |
|---|
| Gene, Accession # | B4GALT2, Gene ID: 8704 |
|---|
| Catalog # | NBP2-58906 |
|---|
| Price | |
|---|
| Order / More Info | beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|