| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | beta-1,3-Glucuronyltransferase 1/B3GAT1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The beta-1,3-Glucuronyltransferase 1/B3GAT1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to beta-1,3-Glucuronyltransferase 1/B3GAT1. This antibody reacts with human. The beta-1,3-Glucuronyltransferase 1/B3GAT1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human beta-1,3-Glucuronyltransferase 1/B3GAT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LLAVHKDEGSDPRRETPPGADPREYCTSDRDIVEVVRTEYVYTRPPPWSDTLPTI |
|---|
| Other Names | Beta-1,3-glucuronyltransferase 1, beta-1,3-glucuronyltransferase 1 (glucuronosyltransferase P), EC 2.4.1.135, galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1, GlcAT-P, GLCATPGLCUATP, glcUAT-P, Glucuronosyltransferase P, NK1, NK-1, UDP-GlcUA:glycoprotein beta-1,3-glucuronyltransferase |
|---|
| Gene, Accession # | B3GAT1, Gene ID: 27087 |
|---|
| Catalog # | NBP2-57597 |
|---|
| Price | |
|---|
| Order / More Info | beta-1,3-Glucuronyltransferase 1/B3GAT1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|