| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Cytosolic Sulfotransferase 1B1/SULT1B1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Cytosolic Sulfotransferase 1B1/SULT1B1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Cytosolic Sulfotransferase 1B1/SULT1B1. This antibody reacts with human. The Cytosolic Sulfotransferase 1B1/SULT1B1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to SULT1B1(sulfotransferase family, cytosolic, 1B, member 1) The peptide sequence was selected from the N terminal of SULT1B1. Peptide sequence MLSPKDILRKDLKLVHGYPMTCAFASNWEKIEQFHSRPDDIVIATYPKSG. |
|---|
| Other Names | EC 2.8.2, EC 2.8.2.-, EC 2.8.2.1, EC 2.8.2.4, MGC13356, ST1B1, ST1B2sulfotransferase family cytosolic 1B member 1, Sulfotransferase 1B1, Sulfotransferase 1B2, sulfotransferase family, cytosolic, 1B, member 1, SULT1B2, Thyroid hormone sulfotransferase |
|---|
| Gene, Accession # | SULT1B1, Gene ID: 27284, Accession: O43704, SwissProt: O43704 |
|---|
| Catalog # | NBP1-54829 |
|---|
| Price | |
|---|
| Order / More Info | Cytosolic Sulfotransferase 1B1/SULT1B1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|