| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Cytosolic Sulfotransferase 2B1/SULT2B1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Cytosolic Sulfotransferase 2B1/SULT2B1. This antibody reacts with human. The Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Cytosolic Sulfotransferase 2B1/SULT2B1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GLWDTYEDDISEISQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFIITYPKS |
|---|
| Other Names | Alcohol sulfotransferase, EC 2.8.2, EC 2.8.2.2, HSST2sulfotransferase family cytosolic 2B member 1, Hydroxysteroid sulfotransferase 2, ST2B1, Sulfotransferase 2B1, sulfotransferase family, cytosolic, 2B, member 1 |
|---|
| Gene, Accession # | SULT2B1, Gene ID: 6820, Accession: O00204, SwissProt: O00204 |
|---|
| Catalog # | NBP2-33396 |
|---|
| Price | |
|---|
| Order / More Info | Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|