| 产品详情 |
| Edit |   |
| Antigenic Specificity | Cytosolic Sulfotransferase 2B1/SULT2B1 |
| Clone | 2E5 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG1 kappa |
| Format | Protein A purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA. Antibody reactivity against cell lysate in WB and recombinant protein in ELISA. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody (2E5) from Novus Biologicals is a mouse monoclonal antibody to Cytosolic Sulfotransferase 2B1/SULT2B1. This antibody reacts with human. The Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody (2E5) has been validated for the following applications: Western Blot, ELISA. |
| Immunogen | SULT2B1 (NP_814444, 1 a.a. - 90 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDGPAEPQIPGLWDTYEDDISEISQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFIITYPKSGTTWMIEIICLILKEGDPS |
| Other Names | Alcohol sulfotransferase, EC 2.8.2, EC 2.8.2.2, HSST2sulfotransferase family cytosolic 2B member 1, Hydroxysteroid sulfotransferase 2, ST2B1, Sulfotransferase 2B1, sulfotransferase family, cytosolic, 2B, member 1 |
| Gene, Accession # | SULT2B1, Gene ID: 6820, Accession: NP_814444, SwissProt: NP_814444 |
| Catalog # | H00006820-M03 |
| Price | |
| Order / More Info | Cytosolic Sulfotransferase 2B1/SULT2B1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|