| Edit |   |
|---|
| Antigenic Specificity | ANKRD65 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ANKRD65 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ANKRD65. This antibody reacts with human. The ANKRD65 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human hCG_20426 (XP_497648). Peptide sequence MDSQRPEPREEEEEEQELRWMELDSEEALGTRTEGPSVVQGWGHLLQAVW. |
|---|
| Other Names | ankyrin repeat domain 65, hypothetical protein LOC441869 |
|---|
| Gene, Accession # | ANKRD65, Gene ID: 441869, Accession: E5RJM6, SwissProt: E5RJM6 |
|---|
| Catalog # | NBP1-91320 |
|---|
| Price | |
|---|
| Order / More Info | ANKRD65 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|