| Edit |   |
|---|
| Antigenic Specificity | ANKRD7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ANKRD7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ANKRD7. This antibody reacts with human. The ANKRD7 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to ANKRD7(ankyrin repeat domain 7) The peptide sequence was selected from the middle region of ANKRD7. Peptide sequence EYEADLEAKNKDGYTPLLVAVINNNPKMVKFLLEKGADVNASDNYQRTAL. |
|---|
| Other Names | ankyrin repeat domain 7, ankyrin repeat domain-containing protein 7, testis-specific ankyrin motif containing protein, Testis-specific protein TSA806, TSA806 |
|---|
| Gene, Accession # | ANKRD7, Gene ID: 56311, Accession: Q92527, SwissProt: Q92527 |
|---|
| Catalog # | NBP1-57699-20ul |
|---|
| Price | |
|---|
| Order / More Info | ANKRD7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|