| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ANKRD13A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ANKRD13A Antibody from Novus Biologicals is a rabbit polyclonal antibody to ANKRD13A. This antibody reacts with human. The ANKRD13A Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ANKRD13A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FGNVNGCSTAEESVSQNVEGTQADSASHITNFEVDQSVFEIPESYYVQDNGRNVHLQDEDYEIMQFAI |
|---|
| Other Names | ANKRD13, ankyrin repeat domain 13, ankyrin repeat domain 13A, ankyrin repeat domain-containing protein 13A, NY-REN-25, NY-REN-25 antigen, Protein KE03 |
|---|
| Gene, Accession # | ANKRD13A, Gene ID: 88455, Accession: Q8IZ07, SwissProt: Q8IZ07 |
|---|
| Catalog # | NBP1-89082 |
|---|
| Price | |
|---|
| Order / More Info | ANKRD13A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|