| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FXYD2 |
|---|
| Clone | 1C3-B3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FXYD2 Antibody (1C3-B3) from Novus Biologicals is a mouse monoclonal antibody to FXYD2. This antibody reacts with human. The FXYD2 Antibody (1C3-B3) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | FXYD2 (AAH05302.1, 1 a.a. - 64 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP |
|---|
| Other Names | ATP1C, ATP1G1ATPase, Na+/K+ transporting, gamma 1 polypeptide, FXYD domain containing ion transport regulator 2, FXYD domain-containing ion transport regulator 2, HOMG2, hypomagnesemia 2, renal, MGC12372, Na(+)/K(+) ATPase subunit gamma, Sodium pump gamma chain, sodium/potassium-transporting ATPase subunit gamma, Sodium-potassium-ATPase, gamma polypeptide |
|---|
| Gene, Accession # | FXYD2, Gene ID: 486, Accession: AAH05302, SwissProt: AAH05302 |
|---|
| Catalog # | H00000486-M01 |
|---|
| Price | |
|---|
| Order / More Info | FXYD2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 20379810, 27805035 |
|---|
| 产品资料 |
|
|