| Edit |   |
| Antigenic Specificity | PRR11 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PRR11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PRR11. This antibody reacts with human. The PRR11 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to PRR11(proline rich 11) The peptide sequence was selected from the middle region of PRR11. Peptide sequence PGKSQMDLRKLLRKVDVERSPGGTPLTNKENMETGTGLTPVMTQALRRKF. |
| Other Names | FLJ11029, proline rich 11, proline-rich protein 11, transcription repressor of MHCII |
| Gene, Accession # | PRR11, Gene ID: 55771, Accession: Q96HE9, SwissProt: Q96HE9 |
| Catalog # | NBP1-55346 |
| Price | |
| Order / More Info | PRR11 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |