| Edit |   |
|---|
| Antigenic Specificity | LRRIQ4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The LRRIQ4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LRRIQ4. This antibody reacts with human. The LRRIQ4 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human LRRIQ4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MPNLEVLDCRHNLLKQLPDAICQAQALKELRLEDNLLTHLPENLDSLVNLKVLTLMDNPMEEPPKEVCAEGNEAIWKYLKENRNRNIMATK |
|---|
| Other Names | Leucine Rich Repeat Containing 64, Leucine-Rich Repeat And IQ Domain-Containing Protein 4, Leucine-Rich Repeat-Containing Protein 64, Leucine-Rich Repeats And IQ Motif Containing 4, LRRC64, LRRIQ4 |
|---|
| Gene, Accession # | LRRIQ4, Gene ID: 344657, Accession: A6NIV6, SwissProt: A6NIV6 |
|---|
| Catalog # | NBP2-30956 |
|---|
| Price | |
|---|
| Order / More Info | LRRIQ4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|