| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | BAF57 |
|---|
| Clone | 6G11 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunoprecipitation. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The BAF57 Antibody (6G11) from Novus Biologicals is a mouse monoclonal antibody to BAF57. This antibody reacts with human. The BAF57 Antibody (6G11) has been validated for the following applications: Western Blot, ELISA, Immunoprecipitation. |
|---|
| Immunogen | SMARCE1 (NP_003070 75 a.a. - 142 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYEAEKIEYNESMKAYHNSPAYLAY |
|---|
| Other Names | BAF57BRG1-associated factor 57, chromatin remodeling complex BRG1-associated factor 57, subfamily e, member 1, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin e1, SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily E member 1 |
|---|
| Gene, Accession # | SMARCE1, Gene ID: 6605, Accession: NP_003070, SwissProt: NP_003070 |
|---|
| Catalog # | H00006605-M01 |
|---|
| Price | |
|---|
| Order / More Info | BAF57 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|