| Edit |   |
|---|
| Antigenic Specificity | CYYR1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CYYR1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CYYR1. This antibody reacts with rat. The CYYR1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to Cyyr1 (cysteine/tyrosine-rich 1) The peptide sequence was selected from the middle region of Cyyr1. Peptide sequence FVYAEDCRAQCGKDCRAYCCNGSTPHCCSYYAYIGSILSGTAIAGIVFGI. |
|---|
| Other Names | C21orf95, cysteine and tyrosine-rich 1, cysteine and tyrosine-rich protein 1, cysteine/tyrosine-rich 1, Proline-rich domain-containing protein |
|---|
| Gene, Accession # | CYYR1, Gene ID: 116159, Accession: Q5PQS5 |
|---|
| Catalog # | NBP1-68916 |
|---|
| Price | |
|---|
| Order / More Info | CYYR1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|