| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Salivary Amylase Alpha |
|---|
| Clone | 2D4 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin. Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Salivary Amylase Alpha Antibody (2D4) from Novus Biologicals is a mouse monoclonal antibody to Salivary Amylase Alpha. This antibody reacts with human. The Salivary Amylase Alpha Antibody (2D4) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | AMY1A (NP_001008222 172 a.a. - 245 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEGSKPFI |
|---|
| Other Names | 1,4-alpha-D-glucan glucanohydrolase 1, alpha-amylase 1, AMY1, AMY1B, AMY1C, amylase, alpha 1A (salivary), amylase, alpha 1A; salivary, amylase, salivary, alpha-1A, EC 3.2.1.1, glycogenase, Salivary alpha-amylase, salivary amylase alpha 1A |
|---|
| Gene, Accession # | AMY1A, Gene ID: 276, Accession: NP_001008222, SwissProt: NP_001008222 |
|---|
| Catalog # | H00000276-M04 |
|---|
| Price | |
|---|
| Order / More Info | Salivary Amylase Alpha Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|