| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CENPF |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CENPF Antibody from Novus Biologicals is a rabbit polyclonal antibody to CENPF. This antibody reacts with human. The CENPF Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human CENPF antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CISELSFSGPNALVPMDFLGNQEDIHNLQLRVKETSNENLRLLHVIEDRDRKVESLLNEMKELDSKLHLQEVQLMTKIEACIELEKIVGELKKENSDLSEKLEYFSCDHQEL |
|---|
| Other Names | AH antigen, cell-cycle-dependent 350K nuclear protein, CENF, CENP-F, CENP-F kinetochore protein, centromere protein F, centromere protein F (350/400kD, mitosin), centromere protein F, 350/400ka (mitosin), centromere protein F, 350/400kDa (mitosin), hcp-1, Kinetochore protein CENPF, mitosin, PRO1779 |
|---|
| Gene, Accession # | CENPF, Gene ID: 1063 |
|---|
| Catalog # | NBP2-56124 |
|---|
| Price | |
|---|
| Order / More Info | CENPF Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|