| 产品详情 |
| Edit |   |
| Antigenic Specificity | Pyridoxal Kinase/PDXK |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Pyridoxal Kinase/PDXK Antibody from Novus Biologicals is a rabbit polyclonal antibody to Pyridoxal Kinase/PDXK. This antibody reacts with human, mouse. The Pyridoxal Kinase/PDXK Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse Pyridoxal Kinase/PDXK antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDIEDPEIVVQATVL |
| Other Names | C21orf124, C21orf97, chromosome 21 open reading frame 124, DKFZp566A071, EC 2.7.1.35, FLJ21324, FLJ37311, MGC15873, MGC31754, MGC52346, PKHchromosome 21 open reading frame 97, PNKhuman pyridoxal kinase, EC 2.7.1.3510FLJ31940, PRED79, pyridoxal (pyridoxine, vitamin B6) kinase, pyridoxal kinase, pyridoxamine kinase, Pyridoxine kinase, vitamin B6 kinase |
| Gene, Accession # | PDXK, Gene ID: 8566 |
| Catalog # | NBP1-88283 |
| Price | |
| Order / More Info | Pyridoxal Kinase/PDXK Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|