| Edit |   |
|---|
| Antigenic Specificity | ACBD4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ACBD4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ACBD4. This antibody reacts with human. The ACBD4 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ACBD4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVIPDMPRPPETFLR RVTGWKEQVVNGDVGAVSEPPCLPKEPA |
|---|
| Other Names | acyl-CoA binding domain containing 4, acyl-CoA-binding domain-containing protein 4, acyl-Coenzyme A binding domain containing 4, FLJ13322, FLJ90623 |
|---|
| Gene, Accession # | ACBD4, Gene ID: 79777, Accession: Q8NC06, SwissProt: Q8NC06 |
|---|
| Catalog # | NBP2-14258 |
|---|
| Price | |
|---|
| Order / More Info | ACBD4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|