| Edit |   |
|---|
| Antigenic Specificity | ACBD4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ACBD4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ACBD4. This antibody reacts with human. The ACBD4 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to ACBD4(acyl-Coenzyme A binding domain containing 4) The peptide sequence was selected from the N terminal of ACBD4. Peptide sequence NSLGKMSREEAMSAYITEMKLVAQKVIDTVPLGEVAEDMFGYFEPLYQVI. |
|---|
| Other Names | acyl-CoA binding domain containing 4, acyl-CoA-binding domain-containing protein 4, acyl-Coenzyme A binding domain containing 4, FLJ13322, FLJ90623 |
|---|
| Gene, Accession # | ACBD4, Gene ID: 79777, Accession: Q8NC06, SwissProt: Q8NC06 |
|---|
| Catalog # | NBP1-59830 |
|---|
| Price | |
|---|
| Order / More Info | ACBD4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|