| Edit |   |
|---|
| Antigenic Specificity | ACBD5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ACBD5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ACBD5. This antibody reacts with human. The ACBD5 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to ACBD5(acyl-Coenzyme A binding domain containing 5) The peptide sequence was selected from the N terminal of ACBD5. Peptide sequence ADTRSVHETRFEAAVKVIQSLPKNGSFQPTNEMMLKFYSFYKQATEGPCK. |
|---|
| Other Names | acyl-CoA binding domain containing 5, acyl-Coenzyme A binding domain containing 5, DKFZp434A2417, endozepine-related protein, KIAA1996acyl-CoA-binding domain-containing protein 5, membrane-associated diazepam binding inhibitor |
|---|
| Gene, Accession # | ACBD5, Gene ID: 91452, Accession: Q5T8D3, SwissProt: Q5T8D3 |
|---|
| Catalog # | NBP1-59820-20ul |
|---|
| Price | |
|---|
| Order / More Info | ACBD5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|