| Edit |   |
| Antigenic Specificity | ACBD5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ACBD5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ACBD5. This antibody reacts with human. The ACBD5 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to ACBD5(acyl-Coenzyme A binding domain containing 5) The peptide sequence was selected from the C terminal of ACBD5. Peptide sequence VRRGRGHRMQHLSEGTKGRQVGSGGDGERWGSDRGSRGSLNEQIALVLMR. |
| Other Names | acyl-CoA binding domain containing 5, acyl-Coenzyme A binding domain containing 5, DKFZp434A2417, endozepine-related protein, KIAA1996acyl-CoA-binding domain-containing protein 5, membrane-associated diazepam binding inhibitor |
| Gene, Accession # | ACBD5, Gene ID: 91452, Accession: Q5T8D3, SwissProt: Q5T8D3 |
| Catalog # | NBP1-59821 |
| Price | |
| Order / More Info | ACBD5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |