| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PRMT2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PRMT2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PRMT2. This antibody reacts with human, mouse, rat. The PRMT2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat PRMT2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWRRHMSVALSW |
|---|
| Other Names | EC 2.1.1.-, EC 2.1.1.125, Histone-arginine N-methyltransferase PRMT2, HMT1, HMT1 (hnRNP methyltransferase, S. cerevisiae)-like 1, HMT1 hnRNP methyltransferase-like 1, HMT1 hnRNP methyltransferase-like 1 (S. cerevisiae), HRMT1L1PRMT2 beta, MGC111373, PRMT2 alpha, PRMT2 gamma, protein arginine methyltransferase 2, protein arginine N-methyltransferase 2 |
|---|
| Gene, Accession # | PRMT2, Gene ID: 3275 |
|---|
| Catalog # | NBP1-83206 |
|---|
| Price | |
|---|
| Order / More Info | PRMT2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|