| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CCRL2/CRAM-A/B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CCRL2/CRAM-A/B Antibody from Novus Biologicals is a rabbit polyclonal antibody to CCRL2/CRAM-A/B. This antibody reacts with human. The CCRL2/CRAM-A/B Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human CCRL2/CRAM-A/B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV |
|---|
| Other Names | C-C chemokine receptor-like 2, CCR11, CCR6, chemokine (C-C motif) receptor-like 2, Chemokine receptor CCR11, Chemokine receptor X, CKRXMGC116710, CRAM, CRAM-A, CRAM-B, FLJ55815, HCRMGC34104, Putative MCP-1 chemokine receptor |
|---|
| Gene, Accession # | CCRL2, Gene ID: 9034 |
|---|
| Catalog # | NBP1-85588 |
|---|
| Price | |
|---|
| Order / More Info | CCRL2/CRAM-A/B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|