| 产品详情 |
| Edit |   |
| Antigenic Specificity | AUF1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The AUF1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to AUF1. This antibody reacts with human. The AUF1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human AUF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGDQQSGYGKVS |
| Other Names | AUF1A, heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein1, 37kDa), heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA-binding protein1, 37kD), heterogeneous nuclear ribonucleoprotein D0, hnRNPD0, type A |
| Gene, Accession # | HNRNPD, Gene ID: 3184 |
| Catalog # | NBP1-88915 |
| Price | |
| Order / More Info | AUF1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|