| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Sonic Hedgehog/Shh |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, chicken |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Sonic Hedgehog/Shh Antibody from Novus Biologicals is a rabbit polyclonal antibody to Sonic Hedgehog/Shh. This antibody reacts with human, chicken. The Sonic Hedgehog/Shh Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to SHH, sonic hedgehog homolog (Drosophila). The peptide sequence was selected from the N-terminal of SHH (NP_000184). Peptide sequence RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT. |
|---|
| Other Names | HHG1, HHG-1, HLP3, HPE3, MCOPCB5sonic hedgehog (Drosophila) homolog, SMMCIsonic hedgehog homolog (Drosophila), sonic hedgehog, sonic hedgehog homolog, sonic hedgehog protein, TPT, TPTPS |
|---|
| Gene, Accession # | SHH, Gene ID: 6469, Accession: Q15465, SwissProt: Q15465 |
|---|
| Catalog # | NBP1-69270 |
|---|
| Price | |
|---|
| Order / More Info | Sonic Hedgehog/Shh Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 27387871 |
|---|
| 产品资料 |
|
|