| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MRCK |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MRCK Antibody from Novus Biologicals is a rabbit polyclonal antibody to MRCK. This antibody reacts with human. The MRCK Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MRCK antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TRRESQSEREEFESEFKQQYEREKVLLTEENKKLTSELDKLTTLYENLSIHNQQLEEEVKD |
|---|
| Other Names | CDC42 binding protein kinase alpha (DMPK-like), CDC42 binidng protein kinase beta, CDC42-binding protein kinase alpha, CDC42-binding protein kinase alpha (DMPK-like), DMPK-like alpha, EC 2.7.11, EC 2.7.11.1, KIAA0451DKFZp686L1738, MRCK, MRCK alpha, MRCKADKFZp686P1738, Myotonic dystrophy kinase-related CDC42-binding kinase alpha, myotonic dystrophy kinase-related CDC42-binding protein kinase alpha, Myotonic dystrophy protein kinase-like alpha, PK428FLJ23347, serine/threonine-protein kinase MRCK alpha, ser-thr protein kinase PK428, ser-thr protein kinase related to the myotonic dystrophy protein kinase |
|---|
| Gene, Accession # | CDC42BPA, Gene ID: 8476 |
|---|
| Catalog # | NBP2-55964 |
|---|
| Price | |
|---|
| Order / More Info | MRCK Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|