| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Creatine kinase MT 1B |
|---|
| Clone | 2C8 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, RNA Inhibition. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA and RNAi Validation. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Creatine kinase MT 1B Antibody (2C8) from Novus Biologicals is a mouse monoclonal antibody to Creatine kinase MT 1B. This antibody reacts with human. The Creatine kinase MT 1B Antibody (2C8) has been validated for the following applications: Western Blot, ELISA, RNA Inhibition. |
|---|
| Immunogen | CKMT1B (NP_066270 327 a.a. - 417 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH |
|---|
| Other Names | Acidic-Type Mitochondrial Creatine Kinase, CKMT, CKMT1, CKMT1B, Creatine Kinase U-Type, Mitochondrial, Creatine Kinase, Mitochondrial 1 (Ubiquitous), Creatine Kinase, Mitochondrial 1B, EC 2.7.3.2, Mia-CK, Ubiquitous Mitochondrial Creatine Kinase, U-MtCK, UMTCK |
|---|
| Gene, Accession # | CKMT1B, Gene ID: 1159, Accession: NP_066270, SwissProt: NP_066270 |
|---|
| Catalog # | H00001159-M04 |
|---|
| Price | |
|---|
| Order / More Info | Creatine kinase MT 1B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|