| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CASZ1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CASZ1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CASZ1. This antibody reacts with human. The CASZ1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CASZ1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: STMTEFLGMFGYDDQNTRDELARKISFEKLHAGSTPEAATSSMLPTSEDTLSKRARFSKYEEYIRKLKAGEQLSWPAPSTKTEERVGKE |
|---|
| Other Names | castor, castor homolog 1, zinc finger, castor homolog 1, zinc finger (Drosophila), castor zinc finger 1, Castor-related protein, CST, dJ734G22.1, FLJ20321, Putative survival-related protein, SRG, SRGcst, survival related, survival-related, Zinc finger protein 693, zinc finger protein castor homolog 1, ZNF693, ZNF693FLJ12223 |
|---|
| Gene, Accession # | CASZ1, Gene ID: 54897 |
|---|
| Catalog # | NBP1-86617 |
|---|
| Price | |
|---|
| Order / More Info | CASZ1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|