| Edit |   |
| Antigenic Specificity | FXYD7 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FXYD7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FXYD7. This antibody reacts with human. The FXYD7 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human FXYD7. Peptide sequence MATPTQTPTKAPEEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKKVK. |
| Other Names | FLJ25096, FXYD domain containing ion transport regulator 7, FXYD domain-containing ion transport regulator 7 |
| Gene, Accession # | FXYD7, Gene ID: 53822, Accession: NP_071289, SwissProt: NP_071289 |
| Catalog # | NBP1-80082-20ul |
| Price | |
| Order / More Info | FXYD7 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |