| Edit |   |
|---|
| Antigenic Specificity | FXYD7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FXYD7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FXYD7. This antibody reacts with human. The FXYD7 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human FXYD7. Peptide sequence MATPTQTPTKAPEEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKKVK. |
|---|
| Other Names | FLJ25096, FXYD domain containing ion transport regulator 7, FXYD domain-containing ion transport regulator 7 |
|---|
| Gene, Accession # | FXYD7, Gene ID: 53822, Accession: NP_071289, SwissProt: NP_071289 |
|---|
| Catalog # | NBP1-80082 |
|---|
| Price | |
|---|
| Order / More Info | FXYD7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|