| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Fyn |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Fyn Antibody from Novus Biologicals is a rabbit polyclonal antibody to Fyn. This antibody reacts with human. The Fyn Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human Fyn antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWE |
|---|
| Other Names | EC 2.7.10, EC 2.7.10.2, FYN oncogene related to SRC, FGR, YES, MGC45350, OKT3-induced calcium influx regulator, p59-Fyn, protein-tyrosine kinase fyn, Proto-oncogene c-Fyn, Proto-oncogene Syn, proto-oncogene tyrosine-protein kinase fyn, SLKc-syn protooncogene, src/yes-related novel, Src-like kinase, SYN, tyrosine kinase p59fyn(T), tyrosine-protein kinase Fyn |
|---|
| Gene, Accession # | FYN, Gene ID: 2534 |
|---|
| Catalog # | NBP2-57212 |
|---|
| Price | |
|---|
| Order / More Info | Fyn Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|