| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PRRX1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PRRX1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PRRX1. This antibody reacts with human. The PRRX1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PRRX1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LDLEEAGDMVAAQADENVGEAGRSLLESPGLTSGSDTPQQDNDQLNSEEK KKRKQRRNR |
|---|
| Other Names | Homeobox protein PHOX1, paired mesoderm homeo box 1, paired mesoderm homeobox 1 isoform pmx-1b, paired mesoderm homeobox protein 1, paired related homeobox 1, Paired-related homeobox protein 1, PHOX1PRX-1, PMX1PRX1 |
|---|
| Gene, Accession # | PRRX1, Gene ID: 5396 |
|---|
| Catalog # | NBP2-13816 |
|---|
| Price | |
|---|
| Order / More Info | PRRX1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23355395, 24946010, 27580127 |
|---|
| 产品资料 |
|
|