| Edit |   |
|---|
| Antigenic Specificity | SUNC1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SUNC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SUNC1. This antibody reacts with human. The SUNC1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to SUNC1(Sad1 and UNC84 domain containing 1) The peptide sequence was selected from the C terminal of SUNC1. Peptide sequence IKLATKIIPTAVTMEHISEKVSPSGNISSAPKEFSVYGITKKCEGEEIFL. |
|---|
| Other Names | MGC33329, Sad1 and UNC84 domain containing 1, Sad1 and UNC84 domain containing 3, Sad1/unc-84 domain-containing protein 1, SUN domain-containing protein 3, SUNC1 |
|---|
| Gene, Accession # | SUN3, Gene ID: 256979, Accession: Q8TAQ9, SwissProt: Q8TAQ9 |
|---|
| Catalog # | NBP1-55413-20ul |
|---|
| Price | |
|---|
| Order / More Info | SUNC1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|