| Edit |   |
|---|
| Antigenic Specificity | SPRR2F |
|---|
| Clone | 5A9 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. It has been used for ELISA and WB. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SPRR2F Antibody (5A9) from Novus Biologicals is a mouse monoclonal antibody to SPRR2F. This antibody reacts with human. The SPRR2F Antibody (5A9) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | SPRR2F (NP_001014450.1, 1 a.a. - 72 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSYQQQQCKQPCQPPPVCPAPKCPEPCPPPKCPEPCPPSKCPQSCPPQQCQQKCPPVTPSPPCQPKCPPKSK |
|---|
| Other Names | small proline-rich protein 2F, SPR-2F |
|---|
| Gene, Accession # | SPRR2F, Gene ID: 6705, Accession: NP_001014450, SwissProt: NP_001014450 |
|---|
| Catalog # | H00006705-M03 |
|---|
| Price | |
|---|
| Order / More Info | SPRR2F Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|