| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SPRTN |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SPRTN Antibody from Novus Biologicals is a rabbit polyclonal antibody to SPRTN. This antibody reacts with human. The SPRTN Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human C1orf124 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SHQNVLSNYFPRVSFANQKAFRGVNGSPRISVTVGNIPKNSVSSSSQRRVSSSKISLRNSSKVTESASVMPSQDVSGSEDT |
|---|
| Other Names | C1orf124, chromosome 1 open reading frame 124, DDDL1880, dJ876B10.3, DKFZP547N043, PRO4323, RP5-876B10.3, Spartan, SprT-like N-terminal domain, zinc finger RAD18 domain-containing protein C1orf124 |
|---|
| Gene, Accession # | SPRTN, Gene ID: 83932 |
|---|
| Catalog # | NBP1-84163 |
|---|
| Price | |
|---|
| Order / More Info | SPRTN Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23042605, 23435261 |
|---|
| 产品资料 |
|
|