| Edit |   |
|---|
| Antigenic Specificity | SPRYD3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SPRYD3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SPRYD3. This antibody reacts with human. The SPRYD3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to the N terminal of SPRYD3. Immunizing peptide sequence LVPQYYSLDHQPGWLPDSVAYHADDGKLYNGRAKGRQFGSKCNSGDRIGC. |
|---|
| Other Names | FLJ14800, SPRY domain containing 3, SPRY domain-containing protein 3 |
|---|
| Gene, Accession # | SPRYD3, Gene ID: 84926, Accession: Q8NCJ5, SwissProt: Q8NCJ5 |
|---|
| Catalog # | NBP1-74270 |
|---|
| Price | |
|---|
| Order / More Info | SPRYD3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|