| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CXADR |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. WB, ICC/IF reported in scientific literature (PMID: 26076477). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CXADR Antibody from Novus Biologicals is a rabbit polyclonal antibody to CXADR. This antibody reacts with human, mouse. The CXADR Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CXADR antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EVHHDIREDVPPPKSRTSTARSYIGSNHSSLGSMSPSNMEGYSKTQYNQVPSEDFERTPQSPTLPPAKVAAPNLS |
|---|
| Other Names | CAR10Coxsackievirus B-adenovirus receptor, CAR4/6, coxsackie virus and adenovirus receptor, coxsackie virus B receptor, coxsackievirus and adenovirus receptor, CVB3 binding protein, CVB3-binding protein, hCAR, HCVADR |
|---|
| Gene, Accession # | CXADR, Gene ID: 1525 |
|---|
| Catalog # | NBP1-88192 |
|---|
| Price | |
|---|
| Order / More Info | CXADR Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 22042635, 24498395, 26076477 |
|---|
| 产品资料 |
|
|