| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Isoleucyl tRNA synthetase |
|---|
| Clone | 3D3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Isoleucyl tRNA synthetase Antibody (3D3) from Novus Biologicals is a mouse monoclonal antibody to Isoleucyl tRNA synthetase. This antibody reacts with human. The Isoleucyl tRNA synthetase Antibody (3D3) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | IARS (NP_038203.1 1172 a.a. - 1262 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QYINLQLLNAKPQECLMGTVGTLLLENPLGQNGLTHQGLLYEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTADF |
|---|
| Other Names | EC 6.1.1, EC 6.1.1.5, FLJ20736, IARS1, ILERS, ILRS, IRS, isoleucine tRNA ligase 1, cytoplasmic, Isoleucine--tRNA ligase, isoleucyl-tRNA synthetase, isoleucyl-tRNA synthetase, cytoplasmic, PRO0785 |
|---|
| Gene, Accession # | IARS, Gene ID: 3376, Accession: NP_038203, SwissProt: NP_038203 |
|---|
| Catalog # | H00003376-M03 |
|---|
| Price | |
|---|
| Order / More Info | Isoleucyl tRNA synthetase Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|