| Edit |   |
|---|
| Antigenic Specificity | IGFBP-4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IGFBP-4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IGFBP-4. This antibody reacts with human. The IGFBP-4 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human IGFBP-4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EDARPVPQGSCQSELHRALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCHQLADSFRE |
|---|
| Other Names | BP-4, HT29-IGFBP, IBP4insulin-like growth factor-binding protein 4, IGF-binding protein 4, IGFBP-4IBP-4, insulin-like growth factor binding protein 4 |
|---|
| Gene, Accession # | IGFBP4, Gene ID: 3487, Accession: P22692, SwissProt: P22692 |
|---|
| Catalog # | NBP2-38086 |
|---|
| Price | |
|---|
| Order / More Info | IGFBP-4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|