| 产品详情 |
| Edit |   |
| Antigenic Specificity | GIPC1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GIPC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GIPC1. This antibody reacts with human. The GIPC1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human GIPC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EAINGQSLLGCRHYEVARLLKELPRGRTFTLKLTEPRKAFDMISQRSAGGRPGSGPQLGTGR |
| Other Names | C19orf3chromosome 19 open reading frame 3, GAIP C-terminus-interacting protein, GIPC PDZ domain containing family, member 1, GIPCRGS-GAIP-interacting protein, GLUT1 C-terminal binding protein, GLUT1CBP, IGF-1 receptor interacting protein 1, MGC15889, MGC3774, NIP, PDZ domain-containing protein GIPC1, regulator of G-protein signalling 19 interacting protein 1, RGS19IP1IIP-1, SEMCAP, SYNECTIIN, SYNECTIN, Tax interaction protein 2, TIP-2RGS19-interacting protein 1 |
| Gene, Accession # | GIPC1, Gene ID: 10755 |
| Catalog # | NBP1-91941 |
| Price | |
| Order / More Info | GIPC1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|