| 产品详情 |
| Edit |   |
| Antigenic Specificity | VIAAT/SLC32A1/VGAT |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The VIAAT/SLC32A1/VGAT Antibody from Novus Biologicals is a rabbit polyclonal antibody to VIAAT/SLC32A1/VGAT. This antibody reacts with human. The VIAAT/SLC32A1/VGAT Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human VIAAT/SLC32A1/VGAT antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ATSVSNKSQAKMSGMFARMGFQAATDEEAVGFAHCDDLDFEHRQGLQMDILKAEGEPCGDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVG |
| Other Names | bA122O1.1, hVIAAT, solute carrier family 32 (GABA vesicular transporter), member 1, Solute carrier family 32 member 1, Vesicular GABA transporter, vesicular inhibitory amino acid transporter, VGATGABA and glycine transporter, VIAAT |
| Gene, Accession # | SLC32A1, Gene ID: 140679, Accession: Q9H598, SwissProt: Q9H598 |
| Catalog # | NBP2-34117 |
| Price | |
| Order / More Info | VIAAT/SLC32A1/VGAT Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|