| Edit |   |
|---|
| Antigenic Specificity | ZNF232 |
|---|
| Clone | 1F8 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZNF232 Antibody (1F8) from Novus Biologicals is a mouse monoclonal antibody to ZNF232. This antibody reacts with human. The ZNF232 Antibody (1F8) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | ZNF232 (NP_055334.2, 181 a.a. - 280 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EKKESLGAAQEALSIQLQPKETQPFPKSEQVYLHFLSVVTEDGPEPKDKGSLPQPPITEVESQVFSEKLATDTSTFEATSEGTLELQQRNPKAERLRWSP |
|---|
| Other Names | zinc finger protein 500, Zinc finger protein with KRAB and SCAN domains 18, ZKSCAN18KIAA0557 |
|---|
| Gene, Accession # | ZNF232, Gene ID: 7775, Accession: NP_055334, SwissProt: NP_055334 |
|---|
| Catalog # | H00007775-M06 |
|---|
| Price | |
|---|
| Order / More Info | ZNF232 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|