| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ZNF235 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ZNF235 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF235. This antibody reacts with human. The ZNF235 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ZNF235 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ASVDDNCLVNHIGDHSSIIENQEFPTGKVPNSWSKIYLNETQNYQRSCKQTQMKNKLCIFAPYVDIFSCISHHH |
|---|
| Other Names | ANF270, HZF6, zfp-93, ZFP93, zinc finger protein 235, zinc finger protein 270, zinc finger protein 6, zinc finger protein 93 homolog, zinc finger protein homologous to mouse Zfp93, zinc finger protein homologous to Zfp93 in mouse, zinc finger protein HZF6, ZNF270 |
|---|
| Gene, Accession # | ZNF235, Gene ID: 9310 |
|---|
| Catalog # | NBP1-92619 |
|---|
| Price | |
|---|
| Order / More Info | ZNF235 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|