| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MAVS |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MAVS Antibody from Novus Biologicals is a rabbit polyclonal antibody to MAVS. This antibody reacts with human. The MAVS Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MAVS antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GSELSKPGVLASQVDSPFSGCFEDLAISASTSLGMGPCHGPEENEYKSEGTFGIHVAENPSIQLLEGNPGPPADPDGGPRPQADRK |
|---|
| Other Names | CARD adapter inducing interferon beta, CARD adapter inducing interferon-beta, CARD adaptor inducing IFN-beta, CARDIF, DKFZp547C224, DKFZp666M015, FLJ27482, IFN-B promoter stimulator 1, Interferon beta promoter stimulator protein 1, interferon-beta promoter stimulator protein 1, IPS-1FLJ41962, IPS1MGC3260, KIAA1271FLJ35386, mitochondrial antiviral signaling protein, mitochondrial antiviral-signaling protein, mitochondrial viral signaling protein, Putative NF-kappa-B-activating protein 031N, virus-induced signaling adapter variant 1b, virus-induced signaling adaptor variant 1a, Virus-induced-signaling adapter, VISAFLJ38051 |
|---|
| Gene, Accession # | MAVS, Gene ID: 57506, Accession: Q7Z434, SwissProt: Q7Z434 |
|---|
| Catalog # | NBP2-38704 |
|---|
| Price | |
|---|
| Order / More Info | MAVS Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|