| Edit |   |
| Antigenic Specificity | ZNF256 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ZNF256 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ZNF256. This antibody reacts with human. The ZNF256 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human ZNF256The immunogen for this antibody is ZNF256. Peptide sequence LYHDVMLENLTLTTSLGGSGAGDEEAPYQQSTSPQRVSQVRIPKALPSPQ. |
| Other Names | zinc finger protein 483, zinc finger protein HIT-10, Zinc finger protein with KRAB and SCAN domains 16, ZKSCAN16KIAA1962 |
| Gene, Accession # | ZNF256, Gene ID: 10172, Accession: NP_005764, SwissProt: NP_005764 |
| Catalog # | NBP1-79233 |
| Price | |
| Order / More Info | ZNF256 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |