| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | YIPF5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The YIPF5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to YIPF5. This antibody reacts with human. The YIPF5 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human YIPF5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NLNTDFYQTSYSIDDQSQQSYDYGGSGGPYSKQYAGYDYSQQGRFVPPDMMQPQQPYTGQIYQPTQAYTPASPQPFYGNNFEDEPPLLE |
|---|
| Other Names | FinGER5, Golgi Membrane Protein SB140, Protein YIPF5, SB140, SMAP5, SMAP-5, Smooth Muscle Cell Associated Protein 5, Smooth Muscle Cell-Associated Protein 5, Yip1 Domain Family Member 5, Yip1 Domain Family, Member 5, YIP1 Family Member 5, YIP1A, YPT-Interacting Protein 1 A |
|---|
| Gene, Accession # | YIPF5, Gene ID: 81555 |
|---|
| Catalog # | NBP2-59007 |
|---|
| Price | |
|---|
| Order / More Info | YIPF5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|