| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | YL1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The YL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to YL1. This antibody reacts with human. The YL1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human YL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RKTAGNRLSGLLEAEEEDEFYQTTYGGFTEESGDDEYQGDQSDTEDEVDSDFDIDEGDEPSSDGEAEE |
|---|
| Other Names | Protein YL-1, Swc2, TCFL1, Transcription factor-like 1, transcription factor-like 1 (YL-1), vacuolar protein sorting 72 (yeast), vacuolar protein sorting 72 homolog (S. cerevisiae), vacuolar protein sorting-associated protein 72 homolog, YL-1, YL1CFL1 |
|---|
| Gene, Accession # | VPS72, Gene ID: 6944 |
|---|
| Catalog # | NBP2-56002 |
|---|
| Price | |
|---|
| Order / More Info | YL1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|