| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | YME1L1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The YME1L1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to YME1L1. This antibody reacts with human. The YME1L1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human YME1L1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AVDGKEMVTMKELEFSKDKILMGPERRSVEIDNKNKTITAYHESGHAIIAYYTKDAMPINKATIMPRGPTLGHVSLLPENDRWNETRAQLLAQMDVS |
|---|
| Other Names | ATP-dependent metalloprotease FtsH1, ATP-dependent metalloprotease FtsH1 homolog, ATP-dependent metalloprotease YME1L1, EC 3.4.24, EC 3.4.24.-, FTSH, FTSH1, Meg-4, MEG4, PAMPATP-dependent zinc metalloprotease YME1L1, Presenilin-associated metalloprotease, YME1 (S.cerevisiae)-like 1, YME1-like 1 (S. cerevisiae), YME1-like protein 1, YME1Lmeg-4 |
|---|
| Gene, Accession # | YME1L1, Gene ID: 10730 |
|---|
| Catalog # | NBP2-49499 |
|---|
| Price | |
|---|
| Order / More Info | YME1L1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|